(data stored in ACNUC7421 zone)

EMBL: CP001402.PE638

CP001402.PE638       Location/Qualifiers
FT   CDS             596085..596747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41274"
FT                   /db_xref="GOA:C4KF58"
FT                   /db_xref="InterPro:IPR011674"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF58"
FT                   /protein_id="ACR41274.1"
FT                   /translation="MVEVSQLITQYKMIYSQYLLSLELYRIETYSLLVLPLMVFAIYYF
FT                   FGKKLKYYYYLIWYKVNKKKKTVSLKSGKDPISNGILVGIVIILLLFGFGIYTLNIQPK
FT                   ENFSEMVILNSNGIIGNYPSHLVPGENALIYVLVQNHEGMPMLYQIKVILNNNNTNITL
FT                   YTSYNIVNNNGEWKLPIAFAINSTGTFKLEVMLYYYNLTLQRFIYTNIFNQLVVSVS"
     MVEVSQLITQ YKMIYSQYLL SLELYRIETY SLLVLPLMVF AIYYFFGKKL KYYYYLIWYK        60
     VNKKKKTVSL KSGKDPISNG ILVGIVIILL LFGFGIYTLN IQPKENFSEM VILNSNGIIG       120
     NYPSHLVPGE NALIYVLVQN HEGMPMLYQI KVILNNNNTN ITLYTSYNIV NNNGEWKLPI       180
     AFAINSTGTF KLEVMLYYYN LTLQRFIYTN IFNQLVVSVS                             220
//

If you have problems or comments...

PBIL Back to PBIL home page