(data stored in ACNUC7421 zone)

EMBL: CP001402.PE639

CP001402.PE639       Location/Qualifiers
FT   CDS             596749..597228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41275"
FT                   /db_xref="GOA:C4KF59"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF59"
FT                   /protein_id="ACR41275.1"
FT                   /translation="MMIMQKREVETSKTVEQMVNELVNKGYSEIEAIKIIHDKYEIENK
FT                   LDFTSIIIHISSLILILSLFNSSSFIISLKIALGIFYSIFFVGYAALRIFYPKELKQLS
FT                   SLHTLGISLATSFAIIAMIGLLLNFTIGITIYTGIIGIVILTETFNIIYNLRGYR"
     MMIMQKREVE TSKTVEQMVN ELVNKGYSEI EAIKIIHDKY EIENKLDFTS IIIHISSLIL        60
     ILSLFNSSSF IISLKIALGI FYSIFFVGYA ALRIFYPKEL KQLSSLHTLG ISLATSFAII       120
     AMIGLLLNFT IGITIYTGII GIVILTETFN IIYNLRGYR                              159
//

If you have problems or comments...

PBIL Back to PBIL home page