(data stored in ACNUC7421 zone)

EMBL: CP001402.PE641

CP001402.PE641       Location/Qualifiers
FT   CDS             597479..599146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0659"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41277"
FT                   /db_xref="GOA:C4KF61"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF61"
FT                   /protein_id="ACR41277.1"
FT                   /translation="MKIEKIQIILLLISIELTLIDIVNISISNYNLLKYPFGLTQELPP
FT                   IYWITEFITATAFIIPLIKFKDFDRNVYNYTMPIAYLLLLFDTFFIFNFINPVFILSRD
FT                   ELGHSAEVFKLLVKHSTMDNPNTYQAYYPLGFIYGGISFLISGFTPTSYFIFFGPMFFT
FT                   IFQNLVVYALLRLFFESPKSELGMLIYMLSSMPFYVAEWSPQLMSYNLLFPVFLILGLI
FT                   IKRGGIRFVPLLILLSELTGLTDIGTFGSAITIIISVLIFSRKIGKLNLKFVIYAATLT
FT                   ASVYIYWVYFNPLAQGALGGVQVLINDFVEVIESIFIPQATKNLVLPSSTLIYTFIPSS
FT                   PYHLYSVVSKLLDGGIFLLTSIISFIYLIVSKKTNNYIWLAFSVGSGLLLMQSAIGLAD
FT                   NISNVLTRMIPQAMTFYTIIIIYFLCDRKILKTIFTLFLVALIPLSVLGYAMIATSEHS
FT                   PEAAFLGGKLLGEYGINTPSTYGFYVALYEYEGKIMQSYGTNLQGIKFAGPYIETLVLY
FT                   FGGPTEVNDYQSYYNGIVQNDTIFFNSGDLIAGVNCFV"
     MKIEKIQIIL LLISIELTLI DIVNISISNY NLLKYPFGLT QELPPIYWIT EFITATAFII        60
     PLIKFKDFDR NVYNYTMPIA YLLLLFDTFF IFNFINPVFI LSRDELGHSA EVFKLLVKHS       120
     TMDNPNTYQA YYPLGFIYGG ISFLISGFTP TSYFIFFGPM FFTIFQNLVV YALLRLFFES       180
     PKSELGMLIY MLSSMPFYVA EWSPQLMSYN LLFPVFLILG LIIKRGGIRF VPLLILLSEL       240
     TGLTDIGTFG SAITIIISVL IFSRKIGKLN LKFVIYAATL TASVYIYWVY FNPLAQGALG       300
     GVQVLINDFV EVIESIFIPQ ATKNLVLPSS TLIYTFIPSS PYHLYSVVSK LLDGGIFLLT       360
     SIISFIYLIV SKKTNNYIWL AFSVGSGLLL MQSAIGLADN ISNVLTRMIP QAMTFYTIII       420
     IYFLCDRKIL KTIFTLFLVA LIPLSVLGYA MIATSEHSPE AAFLGGKLLG EYGINTPSTY       480
     GFYVALYEYE GKIMQSYGTN LQGIKFAGPY IETLVLYFGG PTEVNDYQSY YNGIVQNDTI       540
     FFNSGDLIAG VNCFV                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page