(data stored in ACNUC7421 zone)

EMBL: CP001402.PE645

CP001402.PE645       Location/Qualifiers
FT   CDS             603578..605371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41281"
FT                   /db_xref="GOA:C4KF65"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF65"
FT                   /protein_id="ACR41281.1"
FT                   /translation="MDNVVIYLGIIVAGFLIGILSNIILKRNSLLKSFYIVSVAAINLI
FT                   ILSLILITSLLMRTNLSNTLILLSLLFLSIFFSFYINTYRNILSDINVSAFGLITIVIL
FT                   LLAISPFYISTDRNISYLPFYVTNPKISTSPLFQDYIKILGNPSYYNVYRPNPILSRSL
FT                   EIYSNMVYNLLGNFINQSLSIRNFSNYIYVSLHSGNTSGAIQYYSELLETFDNLTIIKN
FT                   NITYYASILGEYSDSLSFGQFLHILNKNYTEIKNIVNNYYIIMSFIYKLPKTSHVPVEI
FT                   KITKLIIPFNKTVNITGFLISRSNYSINGTLFVKFLNTYRVVNLTNSRFSFPIRLTNYS
FT                   NPIYITILFTGNNIFLPNITTFVVYTNVTFTKLFVKAIPYNPYVGGDVNIVGYVTGYNR
FT                   TLVISLLNYTKTYIVGGNFSIKFPLPYNLTNTTYLLNFTVLPKSYLSPAVKYIVITPKL
FT                   YYENLSVNVIDKWIIPFPLKITGKIYYNNTPLNNVKIFVFIGNSRYETISHNGYFSIEA
FT                   KPKLSVIYGNQIIYVESDPQYAYYREVAEVHTTVYNFMMFIILPLISLFIVILLRKRSK
FT                   ANKLKQFKLKEIPIQGVKNEK"
     MDNVVIYLGI IVAGFLIGIL SNIILKRNSL LKSFYIVSVA AINLIILSLI LITSLLMRTN        60
     LSNTLILLSL LFLSIFFSFY INTYRNILSD INVSAFGLIT IVILLLAISP FYISTDRNIS       120
     YLPFYVTNPK ISTSPLFQDY IKILGNPSYY NVYRPNPILS RSLEIYSNMV YNLLGNFINQ       180
     SLSIRNFSNY IYVSLHSGNT SGAIQYYSEL LETFDNLTII KNNITYYASI LGEYSDSLSF       240
     GQFLHILNKN YTEIKNIVNN YYIIMSFIYK LPKTSHVPVE IKITKLIIPF NKTVNITGFL       300
     ISRSNYSING TLFVKFLNTY RVVNLTNSRF SFPIRLTNYS NPIYITILFT GNNIFLPNIT       360
     TFVVYTNVTF TKLFVKAIPY NPYVGGDVNI VGYVTGYNRT LVISLLNYTK TYIVGGNFSI       420
     KFPLPYNLTN TTYLLNFTVL PKSYLSPAVK YIVITPKLYY ENLSVNVIDK WIIPFPLKIT       480
     GKIYYNNTPL NNVKIFVFIG NSRYETISHN GYFSIEAKPK LSVIYGNQII YVESDPQYAY       540
     YREVAEVHTT VYNFMMFIIL PLISLFIVIL LRKRSKANKL KQFKLKEIPI QGVKNEK          597
//

If you have problems or comments...

PBIL Back to PBIL home page