(data stored in ACNUC7421 zone)

EMBL: CP001402.PE646

CP001402.PE646       Location/Qualifiers
FT   CDS             605361..606014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41282"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF66"
FT                   /protein_id="ACR41282.1"
FT                   /translation="MKNKVSIVLPICILLLLPIIFPDTYPFSPFNIGSQGISYFYNNFE
FT                   NITSSNVTILILMENINNVTPYLIYLLEGNTIIITGNYSNVNNFLHKLNADVIIAPIVL
FT                   TNNLDYYMNNKIIIINESNYTLIFPYAHPIIGGIPLVEVDNNSIIAYYHYGSGKIIIIS
FT                   TPYFFLNSYYKLFNNSEYLHEITGTNKIRIVIYTQVSPLSEFKEFLQSLKSLHL"
     MKNKVSIVLP ICILLLLPII FPDTYPFSPF NIGSQGISYF YNNFENITSS NVTILILMEN        60
     INNVTPYLIY LLEGNTIIIT GNYSNVNNFL HKLNADVIIA PIVLTNNLDY YMNNKIIIIN       120
     ESNYTLIFPY AHPIIGGIPL VEVDNNSIIA YYHYGSGKII IISTPYFFLN SYYKLFNNSE       180
     YLHEITGTNK IRIVIYTQVS PLSEFKEFLQ SLKSLHL                                217
//

If you have problems or comments...

PBIL Back to PBIL home page