(data stored in ACNUC7421 zone)

EMBL: CP001402.PE65

CP001402.PE65        Location/Qualifiers
FT   CDS             complement(56666..58168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0065"
FT                   /product="protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40701"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI1"
FT                   /protein_id="ACR40701.1"
FT                   /translation="MIIGYVIGQATTQEALILAERPVRLGTYVVLEYDNVKALGLITNV
FT                   TRGSPMLDDNMNDIEIVQRLKQFNNSIPVYTKAKVKMLCDMNNHFLMPDIPPFAGTPAR
FT                   EAEDEELKSIYSQDGQIRIGSLIGKNVEVKLNINSFARHLAILAATGSGKSNTVAVLSQ
FT                   RISELGGSVLIFDYHGEYYDSDIKNLNRIEPKLNPLYMTPREFSTLLEIRENAVIQYRI
FT                   LRRAFIKVTNEIREKLKEGQIPFSTLNSQFYELMRDELETQGNSDKKSSAKDEVLNKFE
FT                   EFMDRYSNVIDLTSSDIIEKVKRGKVNVVSLTQLDEDSMDAVVSHYLRRILDSRKDFKR
FT                   SKNSGLKFPIIAVIEEAHVFLSKNENTLTKYWASRIAREGRKFGVGLTIVSQRPKGLDE
FT                   NILSQMTNKIILKIIEPTDKKYILESSDNLSEDLAEQLSSLDVGEAIIIGKIVKLPAVV
FT                   KIDMFEGKLLGSDPDMIGEWKRAEENERIAKGFADFGTEIGD"
     MIIGYVIGQA TTQEALILAE RPVRLGTYVV LEYDNVKALG LITNVTRGSP MLDDNMNDIE        60
     IVQRLKQFNN SIPVYTKAKV KMLCDMNNHF LMPDIPPFAG TPAREAEDEE LKSIYSQDGQ       120
     IRIGSLIGKN VEVKLNINSF ARHLAILAAT GSGKSNTVAV LSQRISELGG SVLIFDYHGE       180
     YYDSDIKNLN RIEPKLNPLY MTPREFSTLL EIRENAVIQY RILRRAFIKV TNEIREKLKE       240
     GQIPFSTLNS QFYELMRDEL ETQGNSDKKS SAKDEVLNKF EEFMDRYSNV IDLTSSDIIE       300
     KVKRGKVNVV SLTQLDEDSM DAVVSHYLRR ILDSRKDFKR SKNSGLKFPI IAVIEEAHVF       360
     LSKNENTLTK YWASRIAREG RKFGVGLTIV SQRPKGLDEN ILSQMTNKII LKIIEPTDKK       420
     YILESSDNLS EDLAEQLSSL DVGEAIIIGK IVKLPAVVKI DMFEGKLLGS DPDMIGEWKR       480
     AEENERIAKG FADFGTEIGD                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page