(data stored in ACNUC7421 zone)

EMBL: CP001402.PE652

CP001402.PE652       Location/Qualifiers
FT   CDS             complement(612620..612916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41288"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF72"
FT                   /protein_id="ACR41288.1"
FT                   /translation="MIENRRRTKTEIIYSILRGCSEGSKKTRLMYLAKLNYSVFMKYIY
FT                   KMKQMNLIEFNEGKCVLTDKGKRVLELLDKYMEMYSELNEVRRKLEELMQTES"
     MIENRRRTKT EIIYSILRGC SEGSKKTRLM YLAKLNYSVF MKYIYKMKQM NLIEFNEGKC        60
     VLTDKGKRVL ELLDKYMEMY SELNEVRRKL EELMQTES                                98
//

If you have problems or comments...

PBIL Back to PBIL home page