(data stored in ACNUC7421 zone)

EMBL: CP001402.PE656

CP001402.PE656       Location/Qualifiers
FT   CDS             617893..619017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41292"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF76"
FT                   /protein_id="ACR41292.1"
FT                   /translation="MVKLKRRDFIGLTIAGGTIAGLVNFLENKPKSNLVQITNKKAFLY
FT                   EYFAIVYGNPEIGYKAIDNNGQILFDGKCSDGTGTCGIYEALEYVESNYGYGKIIIFGN
FT                   FYPVNSPPSISSDVEIEGNATIYVNPNSLPFVLSLRLRKIRVLWYKNIGIINNMLAKRN
FT                   IFSLNPYVLFTNTYESLLLSNGEQTIGEPSSFTISAWVYGEQNPYGGYILSYGSLERGI
FT                   VWTLQSTQNSIIFSGSSGKVSSIAPQSTPFHIGITWNNGYTELYINGKMVNSAEIQIEY
FT                   KSPAYIWINNFPIQSQQSGLNLPSWFSYVENIQLYNSVLSESQILQLASSPIQDPVDQS
FT                   IILWALYRYVMYLGDLITGKGFQRIGALFYNGPM"
     MVKLKRRDFI GLTIAGGTIA GLVNFLENKP KSNLVQITNK KAFLYEYFAI VYGNPEIGYK        60
     AIDNNGQILF DGKCSDGTGT CGIYEALEYV ESNYGYGKII IFGNFYPVNS PPSISSDVEI       120
     EGNATIYVNP NSLPFVLSLR LRKIRVLWYK NIGIINNMLA KRNIFSLNPY VLFTNTYESL       180
     LLSNGEQTIG EPSSFTISAW VYGEQNPYGG YILSYGSLER GIVWTLQSTQ NSIIFSGSSG       240
     KVSSIAPQST PFHIGITWNN GYTELYINGK MVNSAEIQIE YKSPAYIWIN NFPIQSQQSG       300
     LNLPSWFSYV ENIQLYNSVL SESQILQLAS SPIQDPVDQS IILWALYRYV MYLGDLITGK       360
     GFQRIGALFY NGPM                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page