(data stored in ACNUC7421 zone)

EMBL: CP001402.PE657

CP001402.PE657       Location/Qualifiers
FT   CDS             619538..620296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0675"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41293"
FT                   /db_xref="GOA:C4KF77"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF77"
FT                   /protein_id="ACR41293.1"
FT                   /translation="MYTRFKNIRNLRNISESVNTKLIAAISIATALATLLVYQAFVVGF
FT                   VVSNQTTGSVVRINAENALLQIDPIEFTTVSGNGGLSITLPPIAPGTADYAAEIDPGAS
FT                   TPPAMYSAAYLFAIAEVQFNYPGNSNAQAALFASLEDVQANNLPITILVLANPSNNLIQ
FT                   KLTNFPNNEIQIQVVGPGKVNINGQQFWVLATYGLPSNIASQIGTTSVTIGSEGAGANI
FT                   YFLILLGSSGTLPPRGVTFSAALNLYGYQS"
     MYTRFKNIRN LRNISESVNT KLIAAISIAT ALATLLVYQA FVVGFVVSNQ TTGSVVRINA        60
     ENALLQIDPI EFTTVSGNGG LSITLPPIAP GTADYAAEID PGASTPPAMY SAAYLFAIAE       120
     VQFNYPGNSN AQAALFASLE DVQANNLPIT ILVLANPSNN LIQKLTNFPN NEIQIQVVGP       180
     GKVNINGQQF WVLATYGLPS NIASQIGTTS VTIGSEGAGA NIYFLILLGS SGTLPPRGVT       240
     FSAALNLYGY QS                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page