(data stored in ACNUC7421 zone)

EMBL: CP001402.PE658

CP001402.PE658       Location/Qualifiers
FT   CDS             620346..621413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0676"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41294"
FT                   /db_xref="GOA:C4KF78"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF78"
FT                   /protein_id="ACR41294.1"
FT                   /translation="MSSYFLYYTSVKCFKTLINVLLILLIVFSIIITSSNLFGRPTFLA
FT                   ITYGYSMFPVLKPGDVIITIPEPLAGPITNGSIIVFKDPDYGKIPGYPPYIIHQVISIL
FT                   PNGTFITKGINDNFIDQIYMSPITPSDVYGKAILMNGRPLIFPYLGQIIVFLRSNIIFT
FT                   VILFSILIFVNTGISKKGKTIKFSKVAFTISLGVIIFSLLLILSTFFTTYTTIVYSVSN
FT                   RQGILVGGVNQPSAVNLGVILYNQSKQYSYTVSDRLLFPVVVAINVLGEGNYTINNNYF
FT                   ILYPKESHNVTIIILGNGYKGLHQLVVKTYVIVTLLPFSINMNDPLLSLLIYTSINTLA
FT                   LLSFIIIIVMNGDKV"
     MSSYFLYYTS VKCFKTLINV LLILLIVFSI IITSSNLFGR PTFLAITYGY SMFPVLKPGD        60
     VIITIPEPLA GPITNGSIIV FKDPDYGKIP GYPPYIIHQV ISILPNGTFI TKGINDNFID       120
     QIYMSPITPS DVYGKAILMN GRPLIFPYLG QIIVFLRSNI IFTVILFSIL IFVNTGISKK       180
     GKTIKFSKVA FTISLGVIIF SLLLILSTFF TTYTTIVYSV SNRQGILVGG VNQPSAVNLG       240
     VILYNQSKQY SYTVSDRLLF PVVVAINVLG EGNYTINNNY FILYPKESHN VTIIILGNGY       300
     KGLHQLVVKT YVIVTLLPFS INMNDPLLSL LIYTSINTLA LLSFIIIIVM NGDKV            355
//

If you have problems or comments...

PBIL Back to PBIL home page