(data stored in ACNUC7421 zone)

EMBL: CP001402.PE659

CP001402.PE659       Location/Qualifiers
FT   CDS             621410..621814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41295"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF79"
FT                   /protein_id="ACR41295.1"
FT                   /translation="MRMLLYVSIIALLLTIISLSMFTPAFDLSFYTSDIYITSNIINIQ
FT                   KQITSNITLVKINIQLSYLNDYVKCVYIIVYGSSNYYNLTGNYAVTANELIEEGNQPFF
FT                   QFSVSNLNNLKIFIVILYNGGGEGILSYYI"
     MRMLLYVSII ALLLTIISLS MFTPAFDLSF YTSDIYITSN IINIQKQITS NITLVKINIQ        60
     LSYLNDYVKC VYIIVYGSSN YYNLTGNYAV TANELIEEGN QPFFQFSVSN LNNLKIFIVI       120
     LYNGGGEGIL SYYI                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page