(data stored in ACNUC7421 zone)

EMBL: CP001402.PE66

CP001402.PE66        Location/Qualifiers
FT   CDS             complement(58264..58812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40702"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI2"
FT                   /protein_id="ACR40702.1"
FT                   /translation="MALGKETEMGLKELFKANAEDFMSLMLVAEKLEQLGKKEEAKALR
FT                   EKALVELGHAKAIFETLLKNQELRGVVGEMAKEEQEQHISEYNKVAMTAKQEGHEDIEK
FT                   MLCSFADQEAKIAETIAKVSKVLNEMAKEEQEQHISEYNKVAMTAKQEGHEDIEKMLCT
FT                   FAEQEAKISETIKSVAKAL"
     MALGKETEMG LKELFKANAE DFMSLMLVAE KLEQLGKKEE AKALREKALV ELGHAKAIFE        60
     TLLKNQELRG VVGEMAKEEQ EQHISEYNKV AMTAKQEGHE DIEKMLCSFA DQEAKIAETI       120
     AKVSKVLNEM AKEEQEQHIS EYNKVAMTAK QEGHEDIEKM LCTFAEQEAK ISETIKSVAK       180
     AL                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page