(data stored in ACNUC7421 zone)

EMBL: CP001402.PE662

CP001402.PE662       Location/Qualifiers
FT   CDS             623905..624528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41298"
FT                   /db_xref="GOA:C4KF82"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF82"
FT                   /protein_id="ACR41298.1"
FT                   /translation="MLNILALTTFLLAIIFGILTEIAMRKYTKQIDRKQKEISMKKTLD
FT                   FLIFLTELVSDSNVTDLLQEIMIYITSMKGKDWDQIYNATMKKLKPIQDQLNQILNQIE
FT                   ELMNIQRIARKIRFYNRLFRELLILLILTIAILIPFSIIKSLLNFYFYAVLLAIGEFII
FT                   TLIIFLLLIINYNKLNINIIKENSKKNTTMVYRNNSNNISYFMN"
     MLNILALTTF LLAIIFGILT EIAMRKYTKQ IDRKQKEISM KKTLDFLIFL TELVSDSNVT        60
     DLLQEIMIYI TSMKGKDWDQ IYNATMKKLK PIQDQLNQIL NQIEELMNIQ RIARKIRFYN       120
     RLFRELLILL ILTIAILIPF SIIKSLLNFY FYAVLLAIGE FIITLIIFLL LIINYNKLNI       180
     NIIKENSKKN TTMVYRNNSN NISYFMN                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page