(data stored in ACNUC7421 zone)

EMBL: CP001402.PE663

CP001402.PE663       Location/Qualifiers
FT   CDS             complement(625122..625799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41299"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF83"
FT                   /protein_id="ACR41299.1"
FT                   /translation="MVNLYDCALTIEELKMRGYLDISELKEKNLKNIHKFIQFLTRNEI
FT                   VKRRRNRLLLLGDFPKYFVYNISILTNITSDHEEAQSEILINIIPTTTKLYLVEVKEIL
FT                   ARVIGYEKIRIKESIINYSKYTKNFSLDHNLPSWNIISVKSKYFHLIESDNNWKFIKYN
FT                   LYLNMFNFSLNVKFHFNPKDYGIFYSINGEDTRIKCPFNGNNTLKLNLSFPFSTGHYSV
FT                   KWK"
     MVNLYDCALT IEELKMRGYL DISELKEKNL KNIHKFIQFL TRNEIVKRRR NRLLLLGDFP        60
     KYFVYNISIL TNITSDHEEA QSEILINIIP TTTKLYLVEV KEILARVIGY EKIRIKESII       120
     NYSKYTKNFS LDHNLPSWNI ISVKSKYFHL IESDNNWKFI KYNLYLNMFN FSLNVKFHFN       180
     PKDYGIFYSI NGEDTRIKCP FNGNNTLKLN LSFPFSTGHY SVKWK                       225
//

If you have problems or comments...

PBIL Back to PBIL home page