(data stored in ACNUC7421 zone)

EMBL: CP001402.PE664

CP001402.PE664       Location/Qualifiers
FT   CDS             complement(626281..627042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0682"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41300"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF84"
FT                   /protein_id="ACR41300.1"
FT                   /translation="MSYVKVEPNLMKVVEVINKLIYRNGSLCVTFSHIRRETMFHPQTL
FT                   TNLLEKGKTIGLIAECKDLGLGENGYTILQNTVVSLEYSVINEIIKITDNHIIMKHLIK
FT                   NRLYNNSILPLKGIIVKIFGDVLLDMPFIFKGRNNYEIDLTKNILDKYYIFYLDSDIEI
FT                   KPGETYNYEYEFYLKYFPPMDYFITESVNYVMTYSAKTYLTKNEKRVIKSVRLEYPLDV
FT                   KIIEEKQGKTFHEVKIIKLPSCRSIKFWFHI"
     MSYVKVEPNL MKVVEVINKL IYRNGSLCVT FSHIRRETMF HPQTLTNLLE KGKTIGLIAE        60
     CKDLGLGENG YTILQNTVVS LEYSVINEII KITDNHIIMK HLIKNRLYNN SILPLKGIIV       120
     KIFGDVLLDM PFIFKGRNNY EIDLTKNILD KYYIFYLDSD IEIKPGETYN YEYEFYLKYF       180
     PPMDYFITES VNYVMTYSAK TYLTKNEKRV IKSVRLEYPL DVKIIEEKQG KTFHEVKIIK       240
     LPSCRSIKFW FHI                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page