(data stored in ACNUC7421 zone)

EMBL: CP001402.PE669

CP001402.PE669       Location/Qualifiers
FT   CDS             636583..637698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0688"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41305"
FT                   /db_xref="GOA:C4KF89"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF89"
FT                   /protein_id="ACR41305.1"
FT                   /translation="MYRVIELGHVISVPFAGEILRHLGFEVIKVEPLLGDPSRADDVLG
FT                   DSMFIFNNRGKRSISIDLKKDKGREVFLKLIENSHVLIENLSPYAMDRLGLSDDVIFST
FT                   NPSLIYCSVKGYPKGKYENLPAFGTVIEAESGIMDANGKARLPASITDMNASTYCVITI
FT                   LWALLMKKPGHYRVDIIQTNTVWLGYYFIAFQKYGKLFEGGKDELPFWAPYELFKSSEG
FT                   KEFYLAVNDNIKFTKLCKALGLDDLLVDGRFKTNADRVTNRKILHEKLQQKFSSMKLEE
FT                   IINILRYNDIPIGKLNNVKDLVSNELVEWDIFGNVKIPSLPLPGSLNNQDVPDLGEDTL
FT                   NILKELEYSENEIEDMIKENIIMPNRGEKKA"
     MYRVIELGHV ISVPFAGEIL RHLGFEVIKV EPLLGDPSRA DDVLGDSMFI FNNRGKRSIS        60
     IDLKKDKGRE VFLKLIENSH VLIENLSPYA MDRLGLSDDV IFSTNPSLIY CSVKGYPKGK       120
     YENLPAFGTV IEAESGIMDA NGKARLPASI TDMNASTYCV ITILWALLMK KPGHYRVDII       180
     QTNTVWLGYY FIAFQKYGKL FEGGKDELPF WAPYELFKSS EGKEFYLAVN DNIKFTKLCK       240
     ALGLDDLLVD GRFKTNADRV TNRKILHEKL QQKFSSMKLE EIINILRYND IPIGKLNNVK       300
     DLVSNELVEW DIFGNVKIPS LPLPGSLNNQ DVPDLGEDTL NILKELEYSE NEIEDMIKEN       360
     IIMPNRGEKK A                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page