(data stored in ACNUC7421 zone)

EMBL: CP001402.PE67

CP001402.PE67        Location/Qualifiers
FT   CDS             59070..60575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0067"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40703"
FT                   /db_xref="GOA:C4KJI3"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI3"
FT                   /protein_id="ACR40703.1"
FT                   /translation="MISVKEMRALEINSSALGVSTLILMENAGRSVKDEIVKRFNVKDK
FT                   VAYVYVGHGGKGGDGLVAARHLADEGAKVTVILLGENKHEDAILNLNVIEEMDYSITLV
FT                   EIKDMDELKPISADILIDAMLGTGFSGKPREPFRSAIKAFNNSKGFKVSIDVPSGINAD
FT                   TGEAYEDEYVKPDLVVTFHDIKPGLLKYNFNTVVTKIGIPVEAQIYVGPGDLIVNVHSR
FT                   PYYSKKGDSGRVLVIGGSYTFSGAPTLAAMGALRAGADLVYVASPEDTARIIAGYSPDL
FT                   ITIKLRGKNISPDNFEELKSWIDRADVVVIGPGMGLAEETIEASKLIVNYVKEKNKLAV
FT                   IDADALKAISGFDLYENAVITPHAGEFKIFFGEEPNKNIRDRIRQVIRYAKKCKCTVLL
FT                   KGYVDIISDGKRFKLNKTGNPGMTVGGSGDTLTGITATLMAQKIEPFIAAYLGVFINSL
FT                   AGTLAYNRLGAHLTPTDIINEIPNVINNPLDSFKRKLYKRVLS"
     MISVKEMRAL EINSSALGVS TLILMENAGR SVKDEIVKRF NVKDKVAYVY VGHGGKGGDG        60
     LVAARHLADE GAKVTVILLG ENKHEDAILN LNVIEEMDYS ITLVEIKDMD ELKPISADIL       120
     IDAMLGTGFS GKPREPFRSA IKAFNNSKGF KVSIDVPSGI NADTGEAYED EYVKPDLVVT       180
     FHDIKPGLLK YNFNTVVTKI GIPVEAQIYV GPGDLIVNVH SRPYYSKKGD SGRVLVIGGS       240
     YTFSGAPTLA AMGALRAGAD LVYVASPEDT ARIIAGYSPD LITIKLRGKN ISPDNFEELK       300
     SWIDRADVVV IGPGMGLAEE TIEASKLIVN YVKEKNKLAV IDADALKAIS GFDLYENAVI       360
     TPHAGEFKIF FGEEPNKNIR DRIRQVIRYA KKCKCTVLLK GYVDIISDGK RFKLNKTGNP       420
     GMTVGGSGDT LTGITATLMA QKIEPFIAAY LGVFINSLAG TLAYNRLGAH LTPTDIINEI       480
     PNVINNPLDS FKRKLYKRVL S                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page