(data stored in ACNUC7421 zone)

EMBL: CP001402.PE670

CP001402.PE670       Location/Qualifiers
FT   CDS             complement(638325..638498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41306"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF90"
FT                   /protein_id="ACR41306.1"
FT                   /translation="MTSHAVVGYAQKGESDYGDVSPVLLGSKESHDPPIRWLRAKSLYS
FT                   IMIEDKMSELKV"
     MTSHAVVGYA QKGESDYGDV SPVLLGSKES HDPPIRWLRA KSLYSIMIED KMSELKV           57
//

If you have problems or comments...

PBIL Back to PBIL home page