(data stored in ACNUC7421 zone)

EMBL: CP001402.PE671

CP001402.PE671       Location/Qualifiers
FT   CDS             complement(638697..639023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0690"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41307"
FT                   /db_xref="GOA:C4KF91"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF91"
FT                   /protein_id="ACR41307.1"
FT                   /translation="MLVRVCSLLDLEDKKPRKFSINGIEVAIVRVGDKVFAIDAYCPHK
FT                   GRNMEYGDVDGYKIRCDLHGYEYSLENGELVLNPYGKSSGWYFSSNLRIYKVEVKNKDI
FT                   FIQI"
     MLVRVCSLLD LEDKKPRKFS INGIEVAIVR VGDKVFAIDA YCPHKGRNME YGDVDGYKIR        60
     CDLHGYEYSL ENGELVLNPY GKSSGWYFSS NLRIYKVEVK NKDIFIQI                    108
//

If you have problems or comments...

PBIL Back to PBIL home page