(data stored in ACNUC7421 zone)

EMBL: CP001402.PE672

CP001402.PE672       Location/Qualifiers
FT   CDS             complement(639078..639644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0691"
FT                   /product="Ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41308"
FT                   /db_xref="GOA:C4KF92"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014490"
FT                   /db_xref="InterPro:IPR033921"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF92"
FT                   /protein_id="ACR41308.1"
FT                   /translation="MQEKPQEPKVVGVEILEKSGLDVKKLVDKLVKATAAEFTTYYYYT
FT                   ILRMHLTGMEGEGLKEIAEDARLEDRLHFELMTQRLYELGGGLPRDIRQLADISACSDA
FT                   YLPENWKDPKEILKVLLEAEQCAIRTWKEVCDMTYGKDPRTYDLAQRILQEEIEHEAWF
FT                   LELLYGRPSGHFRRSSPGNAPYSKK"
     MQEKPQEPKV VGVEILEKSG LDVKKLVDKL VKATAAEFTT YYYYTILRMH LTGMEGEGLK        60
     EIAEDARLED RLHFELMTQR LYELGGGLPR DIRQLADISA CSDAYLPENW KDPKEILKVL       120
     LEAEQCAIRT WKEVCDMTYG KDPRTYDLAQ RILQEEIEHE AWFLELLYGR PSGHFRRSSP       180
     GNAPYSKK                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page