(data stored in ACNUC7421 zone)

EMBL: CP001402.PE673

CP001402.PE673       Location/Qualifiers
FT   CDS             640026..641147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0692"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41309"
FT                   /db_xref="GOA:C4KF93"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF93"
FT                   /protein_id="ACR41309.1"
FT                   /translation="MADADAASILGGLSTGEEYGYKLIWFVMLLSLPLFIIQEASGRLG
FT                   AISGKGIGELIREYYSRKVSILSIFPIFFVDFFTYLSEYAGIAIGCYLIGIIPLFGLVI
FT                   FFILHVIIVLTKNYEITERYLVVVSVILLLSALIIVGPKLNFTGQEVLYFSTSKNFLFF
FT                   IAVNIGAVVTPPCMLIYQSSATAIKYPKIDINNSKKISWITIETLLGAIITELIIVLSE
FT                   MIGTSIGNIDPTDPARLLYNLGNVHYIFGITLISAGFLTLIVVSLSSAWGLLEALGKNN
FT                   YKNSVKIYIMESIPAMLIVSLMLGNYSSVINFALTLLSLSPIVIAIPAVMVGILISNKK
FT                   IMGKYTYTRTRLVVYFFTIVMIVVGGFVGTLHL"
     MADADAASIL GGLSTGEEYG YKLIWFVMLL SLPLFIIQEA SGRLGAISGK GIGELIREYY        60
     SRKVSILSIF PIFFVDFFTY LSEYAGIAIG CYLIGIIPLF GLVIFFILHV IIVLTKNYEI       120
     TERYLVVVSV ILLLSALIIV GPKLNFTGQE VLYFSTSKNF LFFIAVNIGA VVTPPCMLIY       180
     QSSATAIKYP KIDINNSKKI SWITIETLLG AIITELIIVL SEMIGTSIGN IDPTDPARLL       240
     YNLGNVHYIF GITLISAGFL TLIVVSLSSA WGLLEALGKN NYKNSVKIYI MESIPAMLIV       300
     SLMLGNYSSV INFALTLLSL SPIVIAIPAV MVGILISNKK IMGKYTYTRT RLVVYFFTIV       360
     MIVVGGFVGT LHL                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page