(data stored in ACNUC7421 zone)

EMBL: CP001402.PE675

CP001402.PE675       Location/Qualifiers
FT   CDS             642905..643171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2832"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2832"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41311"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF95"
FT                   /protein_id="ACR41311.1"
FT                   /translation="MDSELEINLRKLGFSVYEAKVYLTLVNYPALTDGASPPHDGDFLL
FT                   LRATSIPLHPQWRFHRTEPFCNAPCGRGVTEGLLSTGLSSPSP"
     MDSELEINLR KLGFSVYEAK VYLTLVNYPA LTDGASPPHD GDFLLLRATS IPLHPQWRFH        60
     RTEPFCNAPC GRGVTEGLLS TGLSSPSP                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page