(data stored in ACNUC7421 zone)

EMBL: CP001402.PE676

CP001402.PE676       Location/Qualifiers
FT   CDS             643930..644673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0695"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41312"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF96"
FT                   /protein_id="ACR41312.1"
FT                   /translation="MMIFRQIISKSGGCATYIFGCTQAGELFVVDPRYEMVDEIVRLAQ
FT                   DLGNMKIAYIIDTHTHADHLSGVKKLQALTNANIYYHEESQVKFKVERIKDGEEIKAGN
FT                   VKIKVIHTPGHTPDSISVLVYDKRRDDSWNEPWAVLTGDTLFVGGVGRIDIGGENAEEN
FT                   LYYSLAKLKGLPDYVEIYPTHTAGSVCGVGISGKPSSTIGFEKRFNTLFRINEKDEFIN
FT                   RVREVKISKPKEFDEYIRKNLEGVI"
     MMIFRQIISK SGGCATYIFG CTQAGELFVV DPRYEMVDEI VRLAQDLGNM KIAYIIDTHT        60
     HADHLSGVKK LQALTNANIY YHEESQVKFK VERIKDGEEI KAGNVKIKVI HTPGHTPDSI       120
     SVLVYDKRRD DSWNEPWAVL TGDTLFVGGV GRIDIGGENA EENLYYSLAK LKGLPDYVEI       180
     YPTHTAGSVC GVGISGKPSS TIGFEKRFNT LFRINEKDEF INRVREVKIS KPKEFDEYIR       240
     KNLEGVI                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page