(data stored in ACNUC7421 zone)

EMBL: CP001402.PE680

CP001402.PE680       Location/Qualifiers
FT   CDS             complement(647855..649693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0699"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41316"
FT                   /db_xref="GOA:C4KFA0"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA0"
FT                   /protein_id="ACR41316.1"
FT                   /translation="MIELSTTKRVILGNEAIAFGALSAGVSIAAGYPGTPSTEIIETLM
FT                   AYGKIYTEWSANEKVAFETAYGAAINGAFALTTMKHVGLNVAADPLMSSSYTGVEGALV
FT                   IVSADDPSMWSSQNEQDNRYYGLHALIPVIEPYDPQSAHDLTIEAFKLSNKVKHPVILR
FT                   STTRIGHIRGPVELKPPSRPILGKLIKDPKRYVLVPENARRNRVEQLKRWEKIEEEVEG
FT                   LNGLIDNDSENLIIASGISFGYVIDAMKELDIKANVLRLSTPVPIPKRLFLKAVSNSKR
FT                   VLIVEEGEPIVEYQIKDLLYDQGIRVELHGKDLVSRVGEMTLDKVYYAFSKFFGLDLVT
FT                   EYLEVPQDIPPRPPALCPGCPHRSSFTDLKKAITMASFKPNETFISGDIGCYTLGLLPP
FT                   FDTQDSSTDMGSSIGIANGVYRATGNIPIAVIGDSTFFHSGISALANAVYTQTPMLVLV
FT                   LDNRSTAMTGQQPSPSKEIDIGEVAKGLGVKYVKYVDPFDVNSSIKELSNALKWVRENK
FT                   QPAVVIAKRACALLVMDNVEENNLPKAIVDLEKCTGCSICYDYFTCPAIIPRKDKKAEI
FT                   DNYTCIGCGACIPVCPFKAISLKGNKPEKWDELWLG"
     MIELSTTKRV ILGNEAIAFG ALSAGVSIAA GYPGTPSTEI IETLMAYGKI YTEWSANEKV        60
     AFETAYGAAI NGAFALTTMK HVGLNVAADP LMSSSYTGVE GALVIVSADD PSMWSSQNEQ       120
     DNRYYGLHAL IPVIEPYDPQ SAHDLTIEAF KLSNKVKHPV ILRSTTRIGH IRGPVELKPP       180
     SRPILGKLIK DPKRYVLVPE NARRNRVEQL KRWEKIEEEV EGLNGLIDND SENLIIASGI       240
     SFGYVIDAMK ELDIKANVLR LSTPVPIPKR LFLKAVSNSK RVLIVEEGEP IVEYQIKDLL       300
     YDQGIRVELH GKDLVSRVGE MTLDKVYYAF SKFFGLDLVT EYLEVPQDIP PRPPALCPGC       360
     PHRSSFTDLK KAITMASFKP NETFISGDIG CYTLGLLPPF DTQDSSTDMG SSIGIANGVY       420
     RATGNIPIAV IGDSTFFHSG ISALANAVYT QTPMLVLVLD NRSTAMTGQQ PSPSKEIDIG       480
     EVAKGLGVKY VKYVDPFDVN SSIKELSNAL KWVRENKQPA VVIAKRACAL LVMDNVEENN       540
     LPKAIVDLEK CTGCSICYDY FTCPAIIPRK DKKAEIDNYT CIGCGACIPV CPFKAISLKG       600
     NKPEKWDELW LG                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page