(data stored in ACNUC7421 zone)

EMBL: CP001402.PE682

CP001402.PE682       Location/Qualifiers
FT   CDS             650483..650638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41318"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA2"
FT                   /protein_id="ACR41318.1"
FT                   /translation="MGYAQKGESDYGDVSPVPLGSNGSHDLPKRWLRAKYLHSIMNEHK
FT                   MIEMKV"
     MGYAQKGESD YGDVSPVPLG SNGSHDLPKR WLRAKYLHSI MNEHKMIEMK V                 51
//

If you have problems or comments...

PBIL Back to PBIL home page