(data stored in ACNUC7421 zone)

EMBL: CP001402.PE684

CP001402.PE684       Location/Qualifiers
FT   CDS             complement(651156..651590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0703"
FT                   /product="protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41320"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA4"
FT                   /protein_id="ACR41320.1"
FT                   /translation="MSWEKSGKEGRLLRWYDVMEAEKYEYTVGPAGEQFFNGLKQGKIV
FT                   GSKCSKCGRIFVPARSYCEHCFVKIENYVEVNKDEAYVDSYTIIYNDDEGNKLAQPVFI
FT                   ALIRFPNVEGGLLCYAEGNVKVEAKAKITSFQWPLRVKVD"
     MSWEKSGKEG RLLRWYDVME AEKYEYTVGP AGEQFFNGLK QGKIVGSKCS KCGRIFVPAR        60
     SYCEHCFVKI ENYVEVNKDE AYVDSYTIIY NDDEGNKLAQ PVFIALIRFP NVEGGLLCYA       120
     EGNVKVEAKA KITSFQWPLR VKVD                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page