(data stored in ACNUC7421 zone)

EMBL: CP001402.PE688

CP001402.PE688       Location/Qualifiers
FT   CDS             complement(654484..655599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0707"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41324"
FT                   /db_xref="GOA:C4KFA8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA8"
FT                   /protein_id="ACR41324.1"
FT                   /translation="MSEKELFIESLREFLKRDVEKIATKIDKEDYYPRDLVRKLGELGF
FT                   LIPLTNGLSHYDMMIILEEIAKVSGSLALIADAQGELAGEMIRLYADERQRKEFLEPMS
FT                   KGEMIGSFALTEPSGGSDIGSMKTFAEKRNGLWRIKGHKMWITQGLYADIFVTVTRTGS
FT                   SRHDLSVFIVPRGNCVETRKIEVMGNRGTGTAEVIFHDCEVSKDYVVGEVNNGWNMVNS
FT                   VLEIGRLAISGIAIGLAEAALEEALKWARSRTAFGNSIYDFQGIRWYFADSVAKLNAVK
FT                   SMAKDVSNKFDENSKDKGVYVAMLKLLSAIIANEIVDISLQVFGGMGYAKGTTIERIYR
FT                   DARLLRIGEGTDEVQRHIIAKYIERYGIPYI"
     MSEKELFIES LREFLKRDVE KIATKIDKED YYPRDLVRKL GELGFLIPLT NGLSHYDMMI        60
     ILEEIAKVSG SLALIADAQG ELAGEMIRLY ADERQRKEFL EPMSKGEMIG SFALTEPSGG       120
     SDIGSMKTFA EKRNGLWRIK GHKMWITQGL YADIFVTVTR TGSSRHDLSV FIVPRGNCVE       180
     TRKIEVMGNR GTGTAEVIFH DCEVSKDYVV GEVNNGWNMV NSVLEIGRLA ISGIAIGLAE       240
     AALEEALKWA RSRTAFGNSI YDFQGIRWYF ADSVAKLNAV KSMAKDVSNK FDENSKDKGV       300
     YVAMLKLLSA IIANEIVDIS LQVFGGMGYA KGTTIERIYR DARLLRIGEG TDEVQRHIIA       360
     KYIERYGIPY I                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page