(data stored in ACNUC7421 zone)

EMBL: CP001402.PE695

CP001402.PE695       Location/Qualifiers
FT   CDS             662852..663625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0714"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41331"
FT                   /db_xref="GOA:C4KFB5"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB5"
FT                   /protein_id="ACR41331.1"
FT                   /translation="MTIGLFISHGSPTILIDENKWKDLLRKVGKEIEEKYKPETIIVSS
FT                   PHFVSWTETFYIESSEKLECIQDYYGFPDETYKYCYNALNDTELVEEIVKNAEGKVVKD
FT                   DKWGLDHGAWIPLFYMFPEYKPKVVTISITDNSPESHYEIGEKIRKAVEKLGRKAVFLA
FT                   TGSPTHRLDLFYFKITPKPTKFDAILMDLIKSGEFEKILKISELYPKEYQTAMPEGNLN
FT                   TLYMLLGYIKPKKAEILGYDTPWPGVSMLAASFYE"
     MTIGLFISHG SPTILIDENK WKDLLRKVGK EIEEKYKPET IIVSSPHFVS WTETFYIESS        60
     EKLECIQDYY GFPDETYKYC YNALNDTELV EEIVKNAEGK VVKDDKWGLD HGAWIPLFYM       120
     FPEYKPKVVT ISITDNSPES HYEIGEKIRK AVEKLGRKAV FLATGSPTHR LDLFYFKITP       180
     KPTKFDAILM DLIKSGEFEK ILKISELYPK EYQTAMPEGN LNTLYMLLGY IKPKKAEILG       240
     YDTPWPGVSM LAASFYE                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page