(data stored in ACNUC7421 zone)

EMBL: CP001402.PE697

CP001402.PE697       Location/Qualifiers
FT   CDS             complement(663918..664325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0716"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41333"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB7"
FT                   /protein_id="ACR41333.1"
FT                   /translation="MDLIELLKFEHGIFRIRFYFMEKVDNSLQELETLHDFIVNVHAKM
FT                   EDLYVFKDIPEAKPYSNDHKLIEKYGDTIIKEKRKDWVPRYMKIVLDHNLNEEKYVFPK
FT                   VKERKGLVLDIIEQYGFESYQKVTGIDIRNF"
     MDLIELLKFE HGIFRIRFYF MEKVDNSLQE LETLHDFIVN VHAKMEDLYV FKDIPEAKPY        60
     SNDHKLIEKY GDTIIKEKRK DWVPRYMKIV LDHNLNEEKY VFPKVKERKG LVLDIIEQYG       120
     FESYQKVTGI DIRNF                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page