(data stored in ACNUC7421 zone)

EMBL: CP001402.PE698

CP001402.PE698       Location/Qualifiers
FT   CDS             664390..664884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0717"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41334"
FT                   /db_xref="GOA:C4KFB8"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB8"
FT                   /protein_id="ACR41334.1"
FT                   /translation="MKFSFLLLLIITVISKTFMLGNYIIYVNVNENFPLVQSVENSTIG
FT                   IKFVVSVKNFTVEPQTIDKLLAIKNSTNFSEIIVPYYLINETFSIVYNGSYYANITISS
FT                   VQVNDSNNFGGNLTNVSFISTSSSPLALNTFYSNGVIVMVLVATFSIVLYTILQNKKKR
FT                   K"
     MKFSFLLLLI ITVISKTFML GNYIIYVNVN ENFPLVQSVE NSTIGIKFVV SVKNFTVEPQ        60
     TIDKLLAIKN STNFSEIIVP YYLINETFSI VYNGSYYANI TISSVQVNDS NNFGGNLTNV       120
     SFISTSSSPL ALNTFYSNGV IVMVLVATFS IVLYTILQNK KKRK                        164
//

If you have problems or comments...

PBIL Back to PBIL home page