(data stored in ACNUC7421 zone)

EMBL: CP001402.PE699

CP001402.PE699       Location/Qualifiers
FT   CDS             complement(664894..665244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0718"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41335"
FT                   /db_xref="InterPro:IPR032603"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB9"
FT                   /protein_id="ACR41335.1"
FT                   /translation="MMEHLSVKELESYLDDDLLKLLKKEDIRHIFLINTKIISNFEKFF
FT                   STFLPYSVKYFVVISSDLPVKIIKESLIRAKDTLEVSCYITSKLPQKSMIIIGLQSVSE
FT                   KEELKELSAFRT"
     MMEHLSVKEL ESYLDDDLLK LLKKEDIRHI FLINTKIISN FEKFFSTFLP YSVKYFVVIS        60
     SDLPVKIIKE SLIRAKDTLE VSCYITSKLP QKSMIIIGLQ SVSEKEELKE LSAFRT           116
//

If you have problems or comments...

PBIL Back to PBIL home page