(data stored in ACNUC7421 zone)

EMBL: CP001402.PE7

CP001402.PE7         Location/Qualifiers
FT   CDS             complement(4154..4867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40643"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC3"
FT                   /protein_id="ACR40643.1"
FT                   /translation="MKCSTKSIREIRGFSFLVPNCDSTLLREKFESFRKLSNEENKTYI
FT                   IRIADSNYFKFEVLMLPNSITLLTISTVRGTNNINLRDFEMVDELQTLACCAYQKEELK
FT                   TATSNFLSPTAQIAEAEVVDLISTDEEFECQTECNNISWNEIKLPESTEGKWTTTELAS
FT                   TGRLYLKALSGQAKFLTISTERPQNSIKFTSMERLGALCCFLTELKRKLNECPALKEVL
FT                   QPYLQVEIGRKRRKR"
     MKCSTKSIRE IRGFSFLVPN CDSTLLREKF ESFRKLSNEE NKTYIIRIAD SNYFKFEVLM        60
     LPNSITLLTI STVRGTNNIN LRDFEMVDEL QTLACCAYQK EELKTATSNF LSPTAQIAEA       120
     EVVDLISTDE EFECQTECNN ISWNEIKLPE STEGKWTTTE LASTGRLYLK ALSGQAKFLT       180
     ISTERPQNSI KFTSMERLGA LCCFLTELKR KLNECPALKE VLQPYLQVEI GRKRRKR          237
//

If you have problems or comments...

PBIL Back to PBIL home page