(data stored in ACNUC7421 zone)

EMBL: CP001402.PE70

CP001402.PE70        Location/Qualifiers
FT   CDS             62629..63438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40706"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI6"
FT                   /protein_id="ACR40706.1"
FT                   /translation="MRILVNGLLPLDSGKTTFSLSIIRLFNQVGIRLFPFKPIAGHNAW
FT                   YSFNTLIRSEELGILVGNDALKYYDETKYDIRRINPFAVLFVPIDLEKLSYNVSLYNMI
FT                   MEYGFPYLIRLSDCINGIDQYFVNSSADIYVPKSMLKFTRNLALKFNAKSYDKMREIID
FT                   ASPQLVDNCTIDVFRNYENVIIESYNDSASPTYNSADVDYVFTVSPTKAFLIKGEEFKK
FT                   ALSLFSIPPWNVRVSTLIKYLKIGKSFEIDVGERVAKDEILDILLKS"
     MRILVNGLLP LDSGKTTFSL SIIRLFNQVG IRLFPFKPIA GHNAWYSFNT LIRSEELGIL        60
     VGNDALKYYD ETKYDIRRIN PFAVLFVPID LEKLSYNVSL YNMIMEYGFP YLIRLSDCIN       120
     GIDQYFVNSS ADIYVPKSML KFTRNLALKF NAKSYDKMRE IIDASPQLVD NCTIDVFRNY       180
     ENVIIESYND SASPTYNSAD VDYVFTVSPT KAFLIKGEEF KKALSLFSIP PWNVRVSTLI       240
     KYLKIGKSFE IDVGERVAKD EILDILLKS                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page