(data stored in ACNUC7421 zone)

EMBL: CP001402.PE700

CP001402.PE700       Location/Qualifiers
FT   CDS             665498..666541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0719"
FT                   /product="transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41336"
FT                   /db_xref="GOA:C4KFC0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025471"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC0"
FT                   /protein_id="ACR41336.1"
FT                   /translation="MPIPSLNTQQIGYKLLSMSNFQGRKGEEVTKTLISASLHKDSVEN
FT                   VSGAYNVSPQTVRNYVEEQGLQVAEKTLEQVKQISLETLKGVKEIELSIDWTTITWYGK
FT                   PVEGLGSSEKGYSWNYATATTKYEGKILILAFIPQVNGMTKDEIVKVLIEQVVAMGFRI
FT                   KLIALDAGFYTVEVIKFVLQFNYIIGVPVGDVKIYEEFDGEHVTNSKRRSKDEQVKFRL
FT                   IVYRREKIKRKKMKVVYFARATNLDLPKNKVLELYNKVRNPIETSYRSVKSFLPFTCST
FT                   KFIFRMLIFLLAVLVYSLYTILKDNVKMRTFKSLISKIIENISEAEIYLNKSEETLTNT
FT                   TGLFLRR"
     MPIPSLNTQQ IGYKLLSMSN FQGRKGEEVT KTLISASLHK DSVENVSGAY NVSPQTVRNY        60
     VEEQGLQVAE KTLEQVKQIS LETLKGVKEI ELSIDWTTIT WYGKPVEGLG SSEKGYSWNY       120
     ATATTKYEGK ILILAFIPQV NGMTKDEIVK VLIEQVVAMG FRIKLIALDA GFYTVEVIKF       180
     VLQFNYIIGV PVGDVKIYEE FDGEHVTNSK RRSKDEQVKF RLIVYRREKI KRKKMKVVYF       240
     ARATNLDLPK NKVLELYNKV RNPIETSYRS VKSFLPFTCS TKFIFRMLIF LLAVLVYSLY       300
     TILKDNVKMR TFKSLISKII ENISEAEIYL NKSEETLTNT TGLFLRR                     347
//

If you have problems or comments...

PBIL Back to PBIL home page