(data stored in ACNUC7421 zone)

EMBL: CP001402.PE702

CP001402.PE702       Location/Qualifiers
FT   CDS             667263..667499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41338"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC2"
FT                   /protein_id="ACR41338.1"
FT                   /translation="MAYVVKVDDRGRIKLPKNLANADSVIIIEAGTFFVGIPIPKDPLA
FT                   ETYGIIKTELSVKELKEIAEKEAERDALGRHSK"
     MAYVVKVDDR GRIKLPKNLA NADSVIIIEA GTFFVGIPIP KDPLAETYGI IKTELSVKEL        60
     KEIAEKEAER DALGRHSK                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page