(data stored in ACNUC7421 zone)

EMBL: CP001402.PE703

CP001402.PE703       Location/Qualifiers
FT   CDS             667496..667915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0722"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41339"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC3"
FT                   /protein_id="ACR41339.1"
FT                   /translation="MMIESDILLAHIKSEDRLKAVADTILLRIARGELKVIASREVFHE
FT                   LYYVLKNMNLSPQEILLRLGALKSIPNIDWVPTTVDTDLLALSLMSQYGISSIFDSYYV
FT                   ATCLLYDKDKIIISTDHIFDKVLGIRRIDPRDFVK"
     MMIESDILLA HIKSEDRLKA VADTILLRIA RGELKVIASR EVFHELYYVL KNMNLSPQEI        60
     LLRLGALKSI PNIDWVPTTV DTDLLALSLM SQYGISSIFD SYYVATCLLY DKDKIIISTD       120
     HIFDKVLGIR RIDPRDFVK                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page