(data stored in ACNUC7421 zone)

EMBL: CP001402.PE706

CP001402.PE706       Location/Qualifiers
FT   CDS             670374..670676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0725"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41342"
FT                   /db_xref="InterPro:IPR032603"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC6"
FT                   /protein_id="ACR41342.1"
FT                   /translation="MPVISIEELSENIEDSLTKMISKSGSVKFVRHVSASLIVDAQKFF
FT                   KTFVPTAKYYIVIVPDNVKNEKVKDELISMSRNSFNFTILYSYKLRDEILIIGYD"
     MPVISIEELS ENIEDSLTKM ISKSGSVKFV RHVSASLIVD AQKFFKTFVP TAKYYIVIVP        60
     DNVKNEKVKD ELISMSRNSF NFTILYSYKL RDEILIIGYD                             100
//

If you have problems or comments...

PBIL Back to PBIL home page