(data stored in ACNUC7421 zone)

EMBL: CP001402.PE707

CP001402.PE707       Location/Qualifiers
FT   CDS             671057..671488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0726"
FT                   /product="death-on-curing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41343"
FT                   /db_xref="GOA:C4KFC7"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC7"
FT                   /protein_id="ACR41343.1"
FT                   /translation="MESKLRAIITSLSKTFIIWLNDRVLKEEDPSLTSIVINEGNIEGA
FT                   IYSALLDFEINHSISRSLAVLIHHLISGHPFADGNKRTATALLLTILSKLYERDIIIED
FT                   RLMKSLITVIAKIANETENEIRELQEIIGEIMRNLANPY"
     MESKLRAIIT SLSKTFIIWL NDRVLKEEDP SLTSIVINEG NIEGAIYSAL LDFEINHSIS        60
     RSLAVLIHHL ISGHPFADGN KRTATALLLT ILSKLYERDI IIEDRLMKSL ITVIAKIANE       120
     TENEIRELQE IIGEIMRNLA NPY                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page