(data stored in ACNUC7421 zone)

EMBL: CP001402.PE71

CP001402.PE71        Location/Qualifiers
FT   CDS             complement(63428..64096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0071"
FT                   /product="protein of unknown function DUF1641"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40707"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI7"
FT                   /protein_id="ACR40707.1"
FT                   /translation="MTNGEFYALDNLLKDEKLNSLNKILDVINTTDRLGILDVIKGILE
FT                   DENTIGKIIGSLTSDDVLELLASWDKIIKTTKLFINDYNIYNIQFLINLIDKVRSRGIL
FT                   DPIIGLLEDEESLGKIINSLINDFTLSLINHWDEITNDLSRIDLTNFKYYTLLVSATGE
FT                   ALKTENVKPITSIWEIYKLLKDPDIQRGLGVAASVLKHIGKLYVPDKGLAFEAEKNSKT
FT                   "
     MTNGEFYALD NLLKDEKLNS LNKILDVINT TDRLGILDVI KGILEDENTI GKIIGSLTSD        60
     DVLELLASWD KIIKTTKLFI NDYNIYNIQF LINLIDKVRS RGILDPIIGL LEDEESLGKI       120
     INSLINDFTL SLINHWDEIT NDLSRIDLTN FKYYTLLVSA TGEALKTENV KPITSIWEIY       180
     KLLKDPDIQR GLGVAASVLK HIGKLYVPDK GLAFEAEKNS KT                          222
//

If you have problems or comments...

PBIL Back to PBIL home page