(data stored in ACNUC7421 zone)

EMBL: CP001402.PE711

CP001402.PE711       Location/Qualifiers
FT   CDS             complement(676556..678406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0730"
FT                   /product="amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41347"
FT                   /db_xref="GOA:C4KFD1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFD1"
FT                   /protein_id="ACR41347.1"
FT                   /translation="MTSVSNSDKLLRKELGLLDLTFLSLSAMIGSGWLLASLSVASIAG
FT                   PSGVLSWIIAGIMVMFIGLAYAELGSSIPKTGGIVRYPVYSHGSYTGFVIAFLYLLSAI
FT                   STPSIEALATIEYLTSVNPTLSKLLTNSTVVNGTPVTILTPPGLLFSILLLFIYFIVNY
FT                   YGIKILGKTNSAITVWKLIIPVVTFILLFFAFKSSNFTNYGGLFPKSVASNYVGPVGML
FT                   YAIPSAGIIYSYLGFRQPIEYSGEAKNPEKNVWRAIILSIVIAILIYTFLQIAFIGAIN
FT                   WVSAGVTPGNWSALLNSKWANSPFYSELEAEGLAIAGAWGYVLLIDAVLSPSGTGLVYT
FT                   GTSARTLYGLSAEEYFPLIFKKLNSYRIPIWSLIVSLIASIIFLLPFPSWYLLVGFNSS
FT                   ATVLTYIMGGIGLQTLRKTAPDLKRGIKIPFASIIAPVATIVSLLIVYWSGFTTLFYII
FT                   SALFIGIPIFWINYSVKILGLKKWIGISLGISQLVVNIILTIIGYYSLVLNNDNPILYF
FT                   ALFILMALTPLVVAYLTVNTNEKVHLKSGFWLMGLIITIYIISYLSEFGPSSNSAPIRF
FT                   PYDIAIISIIGIIFHYLAVLSGFRTREIEEIIEDQKERRD"
     MTSVSNSDKL LRKELGLLDL TFLSLSAMIG SGWLLASLSV ASIAGPSGVL SWIIAGIMVM        60
     FIGLAYAELG SSIPKTGGIV RYPVYSHGSY TGFVIAFLYL LSAISTPSIE ALATIEYLTS       120
     VNPTLSKLLT NSTVVNGTPV TILTPPGLLF SILLLFIYFI VNYYGIKILG KTNSAITVWK       180
     LIIPVVTFIL LFFAFKSSNF TNYGGLFPKS VASNYVGPVG MLYAIPSAGI IYSYLGFRQP       240
     IEYSGEAKNP EKNVWRAIIL SIVIAILIYT FLQIAFIGAI NWVSAGVTPG NWSALLNSKW       300
     ANSPFYSELE AEGLAIAGAW GYVLLIDAVL SPSGTGLVYT GTSARTLYGL SAEEYFPLIF       360
     KKLNSYRIPI WSLIVSLIAS IIFLLPFPSW YLLVGFNSSA TVLTYIMGGI GLQTLRKTAP       420
     DLKRGIKIPF ASIIAPVATI VSLLIVYWSG FTTLFYIISA LFIGIPIFWI NYSVKILGLK       480
     KWIGISLGIS QLVVNIILTI IGYYSLVLNN DNPILYFALF ILMALTPLVV AYLTVNTNEK       540
     VHLKSGFWLM GLIITIYIIS YLSEFGPSSN SAPIRFPYDI AIISIIGIIF HYLAVLSGFR       600
     TREIEEIIED QKERRD                                                       616
//

If you have problems or comments...

PBIL Back to PBIL home page