(data stored in ACNUC7421 zone)

EMBL: CP001402.PE718

CP001402.PE718       Location/Qualifiers
FT   CDS             complement(687271..688353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0737"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41354"
FT                   /db_xref="GOA:C4KFD8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFD8"
FT                   /protein_id="ACR41354.1"
FT                   /translation="MIRISIALLDHQEQLPNMFENLSEDLRKALNEAGYIKPTRVQEVV
FT                   IPELMNGKSVIVQAKTGSGKTAAYVIPILERNSTALILSPTRELATQILDEIKKLGKYK
FT                   QIDVSLIIGGMSYDDQRQSKIVVGTPGRLLDLWSKGKIDFSGYDFVIVDEADRMLDMGF
FT                   IDDIRMILNHCNAKIAGFFSATIPDEIMTLAKEFSKDLREIVLDEYKPVEEVKQKFVKV
FT                   RNDWNDKVSKLLEEINGEKILVFARTRDRARKLYYLLKGKGVNVGLLSGDMPQSVRLKN
FT                   FYGFKKGKYNVLVATDLASRGIDIIDVNKVINFDIPRDVETYIHRVGRTGRMGRVGQAI
FT                   TFYTFREADMIKRINNLLAI"
     MIRISIALLD HQEQLPNMFE NLSEDLRKAL NEAGYIKPTR VQEVVIPELM NGKSVIVQAK        60
     TGSGKTAAYV IPILERNSTA LILSPTRELA TQILDEIKKL GKYKQIDVSL IIGGMSYDDQ       120
     RQSKIVVGTP GRLLDLWSKG KIDFSGYDFV IVDEADRMLD MGFIDDIRMI LNHCNAKIAG       180
     FFSATIPDEI MTLAKEFSKD LREIVLDEYK PVEEVKQKFV KVRNDWNDKV SKLLEEINGE       240
     KILVFARTRD RARKLYYLLK GKGVNVGLLS GDMPQSVRLK NFYGFKKGKY NVLVATDLAS       300
     RGIDIIDVNK VINFDIPRDV ETYIHRVGRT GRMGRVGQAI TFYTFREADM IKRINNLLAI       360
//

If you have problems or comments...

PBIL Back to PBIL home page