(data stored in ACNUC7421 zone)

EMBL: CP001402.PE720

CP001402.PE720       Location/Qualifiers
FT   CDS             689556..690134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0739"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41356"
FT                   /db_xref="GOA:C4KFE0"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE0"
FT                   /protein_id="ACR41356.1"
FT                   /translation="MIILWLRDENLNNCKAVHIHMDKKILIFIVLIVIISFALIMVYPS
FT                   KDLLFSPQEAEAIFGGNWEVLQNNTNLKSIGTITIYYANSTNLTTQHSLEVESIEEEVL
FT                   AGDVNNTKVEITIVIVKFSSNSSWSEIFGNNTNYYKYNGYYITYSATSFTYPKTIIVAY
FT                   KGSTLVEITLDGYQASFAQVKEILSYLNV"
     MIILWLRDEN LNNCKAVHIH MDKKILIFIV LIVIISFALI MVYPSKDLLF SPQEAEAIFG        60
     GNWEVLQNNT NLKSIGTITI YYANSTNLTT QHSLEVESIE EEVLAGDVNN TKVEITIVIV       120
     KFSSNSSWSE IFGNNTNYYK YNGYYITYSA TSFTYPKTII VAYKGSTLVE ITLDGYQASF       180
     AQVKEILSYL NV                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page