(data stored in ACNUC7421 zone)

EMBL: CP001402.PE721

CP001402.PE721       Location/Qualifiers
FT   CDS             complement(690639..691604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0740"
FT                   /product="cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41357"
FT                   /db_xref="GOA:C4KFE1"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE1"
FT                   /protein_id="ACR41357.1"
FT                   /translation="MNTLVDQIISWIIVLYGSAVPALFVIFLIGITGLREITRYETGNT
FT                   FLYKLNPVTKVVLTIVVMIVAATTIWWIGAILTLILLLSYLTLNDGVRKFGYAFFLALS
FT                   TILGGTWSIAPYTPPSTLQLAFPNVKQFTVIWTFPSYFQVMGYEQQLTLEALIYGLQTT
FT                   FRVAPVLLSALLFITTTTGSDIFRMFTKIKIPIAITFSVLVGIRMIPRIFELLDTSVKM
FT                   QYIRGLGYGRPKIVSSLLIVYAIFEAIIPTMVYLFRGAKNLAISADTRGFRAYPSRTSL
FT                   VELKFTRVDYYGTAIIAALIIIAIVANLLGFGRTIPYVGL"
     MNTLVDQIIS WIIVLYGSAV PALFVIFLIG ITGLREITRY ETGNTFLYKL NPVTKVVLTI        60
     VVMIVAATTI WWIGAILTLI LLLSYLTLND GVRKFGYAFF LALSTILGGT WSIAPYTPPS       120
     TLQLAFPNVK QFTVIWTFPS YFQVMGYEQQ LTLEALIYGL QTTFRVAPVL LSALLFITTT       180
     TGSDIFRMFT KIKIPIAITF SVLVGIRMIP RIFELLDTSV KMQYIRGLGY GRPKIVSSLL       240
     IVYAIFEAII PTMVYLFRGA KNLAISADTR GFRAYPSRTS LVELKFTRVD YYGTAIIAAL       300
     IIIAIVANLL GFGRTIPYVG L                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page