(data stored in ACNUC7421 zone)

EMBL: CP001402.PE723

CP001402.PE723       Location/Qualifiers
FT   CDS             complement(693177..693902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0742"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41359"
FT                   /db_xref="GOA:C4KFE3"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE3"
FT                   /protein_id="ACR41359.1"
FT                   /translation="MAFNGIKFDTSVPGMVPWEIVTIYFIVGLAIVFYFARRFGLKSFT
FT                   TIDLVYIAVGAAFSVVWEFYIGSFIGRFLPSTPFIGVGFWGRMLILLIVAALVRKPGTG
FT                   ILSLLIFNILSDLFFYGFGGEPMYTIYEALTYGLFLDLVIVASRGKLFGIGYKSSNGPS
FT                   VATKTVVGLAILEGVIIGILFAIPDPIFYLGFFRPLISGAIVNWATIQFDFLAFIPGDV
FT                   IIGILGALAGQRIAKAVGQ"
     MAFNGIKFDT SVPGMVPWEI VTIYFIVGLA IVFYFARRFG LKSFTTIDLV YIAVGAAFSV        60
     VWEFYIGSFI GRFLPSTPFI GVGFWGRMLI LLIVAALVRK PGTGILSLLI FNILSDLFFY       120
     GFGGEPMYTI YEALTYGLFL DLVIVASRGK LFGIGYKSSN GPSVATKTVV GLAILEGVII       180
     GILFAIPDPI FYLGFFRPLI SGAIVNWATI QFDFLAFIPG DVIIGILGAL AGQRIAKAVG       240
     Q                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page