(data stored in ACNUC7421 zone)

EMBL: CP001402.PE726

CP001402.PE726       Location/Qualifiers
FT   CDS             complement(695374..695904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0745"
FT                   /product="Protein of unknown function DUF1286"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41362"
FT                   /db_xref="GOA:C4KFE6"
FT                   /db_xref="InterPro:IPR009705"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE6"
FT                   /protein_id="ACR41362.1"
FT                   /translation="MNLVRLRTHYIFSTGLLTFLDSVLFHEYFYYALILSGIVSVIGNF
FT                   LIDRIGHKEVATRYGYIPVRTPLTHTIPRSVVWGVVSVVPVFILLLIYYYGFSYHEYYF
FT                   SLSNKVVLLILLNGVVVGPSHLFLDVFTERGIYVKKYGRWRRFALAHFRYDNPLVNGLA
FT                   IIAGAVMIYLAYL"
     MNLVRLRTHY IFSTGLLTFL DSVLFHEYFY YALILSGIVS VIGNFLIDRI GHKEVATRYG        60
     YIPVRTPLTH TIPRSVVWGV VSVVPVFILL LIYYYGFSYH EYYFSLSNKV VLLILLNGVV       120
     VGPSHLFLDV FTERGIYVKK YGRWRRFALA HFRYDNPLVN GLAIIAGAVM IYLAYL           176
//

If you have problems or comments...

PBIL Back to PBIL home page