(data stored in ACNUC7421 zone)

EMBL: CP001402.PE73

CP001402.PE73        Location/Qualifiers
FT   CDS             65481..66074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40709"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI9"
FT                   /protein_id="ACR40709.1"
FT                   /translation="MQQLIDKFLEVKGRKIHYIESGDDSPVLLFHGARFNARTWVETNT
FT                   VDSISNIGYKAISVDFPGFGSSEKIEGISLSEFINLFMNSLGISKAILLGASMGGKAVL
FT                   EFSLKYTESVYGLVLVGAVGVEEFEDQISKLNKIPLLLIWGSRDTVSPKRNYELILDKV
FT                   KNAKLEIVGKNHACYLDDPNTFNEKIVNFLKGMK"
     MQQLIDKFLE VKGRKIHYIE SGDDSPVLLF HGARFNARTW VETNTVDSIS NIGYKAISVD        60
     FPGFGSSEKI EGISLSEFIN LFMNSLGISK AILLGASMGG KAVLEFSLKY TESVYGLVLV       120
     GAVGVEEFED QISKLNKIPL LLIWGSRDTV SPKRNYELIL DKVKNAKLEI VGKNHACYLD       180
     DPNTFNEKIV NFLKGMK                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page