(data stored in ACNUC7421 zone)

EMBL: CP001402.PE730

CP001402.PE730       Location/Qualifiers
FT   CDS             697191..698492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0748"
FT                   /product="integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41366"
FT                   /db_xref="GOA:C4KFF0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFF0"
FT                   /protein_id="ACR41366.1"
FT                   /translation="MRHSKLIYINYVDGYLLIMDTTKLDDDKKLKILEKAIEKFGKAYI
FT                   AQKCGVSRQTIYRYLKREIQSIPDEFIQCVSNFLSIEELGDIVYGLRTVEVDENIALSV
FT                   IVKMKRDPNFRAFFLSLMKQFLGEYIQDASTSYVITKNDVDRFLNYIKSKSNTTYKTFK
FT                   NYFVKTIAELNYTLTPEAVKDYITKEMTISKGRASHISKILKLFIKEIIIPKNSSLGRE
FT                   LYNSFKTIKVEKEYSPESLTLEDLKRVFTTIEHIGAKAFFLLLAETGLRINEILKLNID
FT                   QIDLEKRIIYVNKISASKRAYITFLHENTAKWLKETYLPYREEFINKYEKKLRNININV
FT                   EAWKNRLFPINEYNMRKEIKEAMKKVLSREFRLYDLRSFFASYMIKQGVSPMIVNLLQG
FT                   RAPPQQFQILQNHYFVVSDIELQQYYDKYAPRLL"
     MRHSKLIYIN YVDGYLLIMD TTKLDDDKKL KILEKAIEKF GKAYIAQKCG VSRQTIYRYL        60
     KREIQSIPDE FIQCVSNFLS IEELGDIVYG LRTVEVDENI ALSVIVKMKR DPNFRAFFLS       120
     LMKQFLGEYI QDASTSYVIT KNDVDRFLNY IKSKSNTTYK TFKNYFVKTI AELNYTLTPE       180
     AVKDYITKEM TISKGRASHI SKILKLFIKE IIIPKNSSLG RELYNSFKTI KVEKEYSPES       240
     LTLEDLKRVF TTIEHIGAKA FFLLLAETGL RINEILKLNI DQIDLEKRII YVNKISASKR       300
     AYITFLHENT AKWLKETYLP YREEFINKYE KKLRNININV EAWKNRLFPI NEYNMRKEIK       360
     EAMKKVLSRE FRLYDLRSFF ASYMIKQGVS PMIVNLLQGR APPQQFQILQ NHYFVVSDIE       420
     LQQYYDKYAP RLL                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page