(data stored in ACNUC7421 zone)

EMBL: CP001402.PE731

CP001402.PE731       Location/Qualifiers
FT   CDS             698632..698898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0749"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41367"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFF1"
FT                   /protein_id="ACR41367.1"
FT                   /translation="MELKRVYEDEDIIATYSPSYYEIKLLIMSLMREYKKKYNYYFTTV
FT                   SLHKELEKRGLQISPGMIRKILHELKKQGLVKEKINHKYIPHF"
     MELKRVYEDE DIIATYSPSY YEIKLLIMSL MREYKKKYNY YFTTVSLHKE LEKRGLQISP        60
     GMIRKILHEL KKQGLVKEKI NHKYIPHF                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page