(data stored in ACNUC7421 zone)

EMBL: CP001402.PE74

CP001402.PE74        Location/Qualifiers
FT   CDS             66071..66712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40710"
FT                   /db_xref="InterPro:IPR017139"
FT                   /db_xref="InterPro:IPR019254"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ0"
FT                   /protein_id="ACR40710.1"
FT                   /translation="MSDKEELSVKLRIILRDIRYLTILKHLKIANVDYGKSIMLNTKIP
FT                   LAEIVEILDDLERLGLIERVHGATLKNTEAKFKLSSEVHKHHTYYRLTREGDHLLRHLE
FT                   DRMLIDAYMEIVKNDNLALSILRLADELNADHALTYAKLTHKRLEEITPKIEELVKMGL
FT                   LEEKNSKIIKFADRKAKPKKETRTHHKYYGLSRIGELVVREMKRRGILPK"
     MSDKEELSVK LRIILRDIRY LTILKHLKIA NVDYGKSIML NTKIPLAEIV EILDDLERLG        60
     LIERVHGATL KNTEAKFKLS SEVHKHHTYY RLTREGDHLL RHLEDRMLID AYMEIVKNDN       120
     LALSILRLAD ELNADHALTY AKLTHKRLEE ITPKIEELVK MGLLEEKNSK IIKFADRKAK       180
     PKKETRTHHK YYGLSRIGEL VVREMKRRGI LPK                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page