(data stored in ACNUC7421 zone)

EMBL: CP001402.PE77

CP001402.PE77        Location/Qualifiers
FT   CDS             68175..68462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0077"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40713"
FT                   /db_xref="GOA:C4KJJ3"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ3"
FT                   /protein_id="ACR40713.1"
FT                   /translation="MFKMWYLHISIAIIALILSSLVVLEFVRMRKEFRGKLTTVLVLLS
FT                   SFLIAQFGSFLLDFIMWSNDKNPIYIYPSLITVSLSFITILLFYYYITKI"
     MFKMWYLHIS IAIIALILSS LVVLEFVRMR KEFRGKLTTV LVLLSSFLIA QFGSFLLDFI        60
     MWSNDKNPIY IYPSLITVSL SFITILLFYY YITKI                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page